PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn121951
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 291aa    MW: 31943.6 Da    PI: 6.6593
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn121951genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W+ ++   g+ R+ k+c++rw +yl
       Achn121951 14 KGPWTPEEDIILVSYIQEHGPGNWRVVPTNTGLLRCSKSCRLRWINYL 61
                     79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.084965IPR017930Myb domain
SMARTSM007175.4E-141363IPR001005SANT/Myb domain
PfamPF002497.6E-161461IPR001005SANT/Myb domain
SuperFamilySSF466891.48E-211588IPR009057Homeodomain-like
CDDcd001679.39E-121661No hitNo description
PROSITE profilePS500904.39162122IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.2E-66588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MVRPPCCDKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRVV PTNTGLLRCS KSCRLRWINY  60
LRPGIKRGNF TDHEEKMIIH LQALLGNRKL QGYGGGQGDS QDELISPNSH SSKSKGQWER  120
RLQTDIHEAK QALYEALSLD KSSNSNISQL KPSDIGYYPA QSTTTYASST DNIARLLQNW  180
MKSSPKSPQS SSENNISQNS FNNNLVGNNN LVCIGSSPSN EGCNSLFCFN SSNSDASQSE  240
TSKPNLENQV VPLSLLEKWL FDDGGAQGLG GLMDVSLGET DDGLFQRLGF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-131488477MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283575.11e-104PREDICTED: myb-related protein 306
RefseqXP_007209276.11e-103hypothetical protein PRUPE_ppa007562mg
RefseqXP_009594207.11e-104PREDICTED: myb-related protein 306
RefseqXP_010661068.11e-104PREDICTED: myb-related protein 306
RefseqXP_016450803.11e-104PREDICTED: myb-related protein 306-like
SwissprotP813926e-92MYB06_ANTMA; Myb-related protein 306
TrEMBLM4ME361e-106M4ME36_PAESU; MYB1 protein
STRINGVIT_14s0108g00830.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.16e-76myb domain protein 94